PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_00678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 343aa    MW: 36539.9 Da    PI: 6.3941
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_00678genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.3e-071761339
    zf-B_box  3 erkCpeHeeke..lqlfCedCqqllCedClleeHkg.......Htv 39
                +rkC+ ++  +  + lfC+ +  +lC++C    H g       H++
  PEQU_00678 17 ARKCDGCKGPPaaAVLFCRADAAFLCATCDARVH-GanklasrHER 61
                789*****86667******************999.44667777765 PP

2zf-B_box25.42.9e-0862107342
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                  + C+ +e+ ++   C+ +   lC  C   +H        H++vp+
  PEQU_00678  62 VWLCEVCEQAPAAVTCKADAAALCSACDADIHTAnplasrHQRVPV 107
                 689*****************************66899999999986 PP

3CCT69.77.4e-24252295144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea+++RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  PEQU_00678 252 REARVMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 295
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.0E-131564IPR000315B-box-type zinc finger
PROSITE profilePS501199.7981564IPR000315B-box-type zinc finger
CDDcd000219.30E-81864No hitNo description
PROSITE profilePS5011910.53760107IPR000315B-box-type zinc finger
PfamPF006435.1E-662107IPR000315B-box-type zinc finger
CDDcd000211.98E-963107No hitNo description
SMARTSM003368.9E-965107IPR000315B-box-type zinc finger
PfamPF062036.5E-18252294IPR010402CCT domain
PROSITE profilePS5101716.906252294IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGGKGVEGGG AYWELEARKC DGCKGPPAAA VLFCRADAAF LCATCDARVH GANKLASRHE  60
RVWLCEVCEQ APAAVTCKAD AAALCSACDA DIHTANPLAS RHQRVPVVPL FESPVPDPSL  120
LYDADDGEED SAGAASWILP APAKDTVQGK MKSADCFTDV HPYLDLEYGS SVEAGIYQSD  180
SVVPAGAGAS SGLIMLDFGK SKPKTHSYTI SHSMSSSEVA VVPDGGGSAM ADVSNCAGGS  240
GGVGERSTMM DREARVMRYR EKRKNRRFEK TIRYASRKAY AETRPRIKGR FAKRTEVELE  300
IDQIYSSAGA PTARFLXXXX XAWPAATAAF IESVQDYGVV PSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
119GGKGVEGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4699860.0FJ469986.1 Phalaenopsis hybrid cultivar CONSTANS-like protein (COL) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008789696.11e-125PREDICTED: zinc finger protein CONSTANS-LIKE 4 isoform X1
SwissprotQ9FHH89e-81COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLE6Y7M50.0E6Y7M5_9ASPA; CONSTANS-like protein
STRINGGSMUA_Achr11P08210_0011e-103(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.18e-66CONSTANS-like 5